tirzepatide
Tirzepatide Price range: $90.00 through $150.00
Back to products
retatrutide
Retatrutide Price range: $90.00 through $165.00

Semaglutide

Price range: $75.00 through $110.00

This product is in lyophilized powder form.

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

THIS IS NOT FOR HUMAN CONSUMPTION. FOR RESEARCH USE ONLY!

Description

Product Catalog: Peptide Research Reagents

Document ID: SEM-2026-v1.0

Date: March 2026

Product Data Sheet: Semaglutide (Research Grade)

⚠️ WARNING: RESEARCH USE ONLYThis product is strictly for laboratory research and development purposes only. It is NOT intended for human consumption, therapeutic use, diagnostic use, or administration to humans or animals. This product is sold as a lyophilized powder for in vitro research applications.

1. Product Overview

Semaglutide is a synthetic peptide analog that functions as a selective glucagon-like peptide-1 (GLP-1) receptor agonist. It is a linear peptide composed of 31 amino acids that has been chemically modified with a C18 fatty diacid chain attached via a gamma-glutamic acid spacer. This structural modification allows for albumin binding and resistance to DPP-4 degradation, thereby extending its half-life in research models.

In research settings, this compound is utilized to study metabolic pathways, insulin secretion mechanisms, appetite regulation, and the physiological effects of selective GLP-1 receptor activation. It serves as a critical tool for investigating the pathophysiology of type 2 diabetes, obesity, and cardiovascular metabolism in non-clinical models.

2. Technical Specifications

Product Name Semaglutide (Lyophilized)
CAS Number 910463-68-2
Chemical Formula C187H291N45O59
Molecular Weight 4113.58 g/mol
Purity (HPLC) ≥ 99.0%
Appearance White to off-white lyophilized powder
Solubility Soluble in sterile water, bacteriostatic water, or saline
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (Modified with C18 fatty diacid via gamma-Glu spacer at Lys26)

3. Research Applications

Semaglutide is intended exclusively for use in qualified research laboratories. Common areas of investigation include:

  • Metabolic Regulation: Investigation of selective GLP-1 receptor agonism on glucose homeostasis, insulin secretion, and lipid metabolism in cellular assays.
  • Receptor Binding Affinity: In vitro studies measuring binding kinetics, selectivity, and potency at GLP-1 receptors compared to native GLP-1.
  • Cellular Signaling: Analysis of cAMP production and downstream signaling pathways in pancreatic beta-cell lines.
  • Adiposity and Appetite Regulation: Research into the mechanisms of weight regulation, satiety signaling, gastric emptying, and energy expenditure in animal models (subject to institutional ethical approval).

4. Storage and Handling

Proper storage is essential to maintain the stability and integrity of the peptide. Please adhere to the following guidelines:

Storage of Lyophilized Powder

  • Long-term Storage: Store at -20°C (-4°F) or colder. Stable for up to 2 years if kept desiccated and away from light.
  • Short-term Storage: Can be stored at 2-8°C (36-46°F) for up to 3 months.
  • Room Temperature: Avoid prolonged exposure to room temperature. Transport should be conducted with cold packs.

Reconstitution and Handling

  • Allow the vial to reach room temperature before opening to prevent condensation.
  • Reconstitute using Sterile Water for Injection (SWFI) or Bacteriostatic Water. Gently swirl the vial; do not shake vigorously.
  • Once reconstituted, the solution should be stored at 2-8°C and used within 14-21 days. Do not freeze after reconstitution as freeze-thaw cycles degrade the peptide structure.
  • Use appropriate personal protective equipment (PPE), including gloves, lab coat, and eye protection, when handling this substance.

5. Safety and Hazard Information

While this product is not classified as a dangerous good for transport, standard laboratory safety protocols must be observed.

  • Potential Hazards: May cause irritation to skin, eyes, and respiratory tract. Avoid inhalation of powder.
  • First Aid:
    • Skin Contact: Wash thoroughly with soap and water.
    • Eye Contact: Rinse cautiously with water for several minutes.
    • Ingestion: Rinse mouth. Do NOT induce vomiting. Seek medical advice.
  • Disposal: Dispose of contents/container in accordance with local, regional, and national regulations regarding chemical waste.
Additional information
Weight N/A
Dimensions N/A
10MG,20MG

10MG

,

20MG

Reviews (0)

Reviews

There are no reviews yet.

Be the first to review “Semaglutide”

Your email address will not be published. Required fields are marked *